Current Position:Home>>Kits>>ELISA Kits>> Human FGF7/KGF(Fibroblast Growth Factor 7) ELISA Kit
Cat.No.:E-EL-H0092
Welcome to order from local distributors.
Add to cart Bulk requestFor research use only. Order now, ship in 3 days
Assay type | Sandwich-ELISA |
Format | 96T/48T |
Assay time | 3.5h |
Detection range | 31.25-2000 pg/mL |
Sensitivity | 18.75 pg/mL |
Sample type &Sample volume | serum, plasma and other biological fluids; 100μL |
Specificity | This kit recognizes Human FGF7/KGF in samples. No significant cross-reactivity or interference between Human FGF7/KGF and analogues was observed. |
Reproducibility | Both intra-CV and inter-CV are < 10%. |
Application | This ELISA kit applies to the in vitro quantitative determination of Human FGF7/KGF concentrations in serum, plasma and other biological fluids. |
Item | Specifications | Storage |
---|---|---|
Micro ELISA Plate(Dismountable) | 96T: 8 wells ×12 strips
48T: 8 wells ×6 strips |
-20℃, 6 months |
Reference Standard | 96T: 2 vials
48T: 1 vial |
|
Concentrated Biotinylated Detection Ab (100×) | 96T: 1 vial, 120 μL
48T: 1 vial, 60 μL |
|
Concentrated HRP Conjugate (100×) | 96T: 1 vial, 120 μL
48T: 1 vial, 60 μL |
-20℃(Protect from light), 6 months |
Reference Standard & Sample Diluent | 1 vial, 20 mL | 2-8°C, 6 months |
Biotinylated Detection Ab Diluent | 1 vial, 14 mL | |
HRP Conjugate Diluent | 1 vial, 14 mL | |
Concentrated Wash Buffer (25×) | 1 vial, 30 mL | |
Substrate Reagent | 1 vial, 10 mL | 2-8℃(Protect from light) |
Stop Solution | 1 vial, 10 mL | 2-8°C |
Plate Sealer | 5 pieces | |
Manual | 1 copy | |
Certificate of Analysis | 1 copy |
Intra-assay Precision (Precision within an assay): 3 samples with low, mid range and high level Human FGF7/KGF were tested 20 times on one plate, respectively.
Inter-assay Precision (Precision between assays): 3 samples with low, mid range and high level Human FGF7/KGF were tested on 3 different plates, 20 replicates in each plate.
Intra-assay Precision | Inter-assay Precision | |||||
---|---|---|---|---|---|---|
Sample | 1 | 2 | 3 | 1 | 2 | 3 |
n | 20 | 20 | 20 | 20 | 20 | 20 |
Mean (pg/mL) | 100.69 | 217.61 | 889.61 | 96.83 | 210.35 | 850.06 |
Standard deviation | 6.19 | 9.29 | 39.77 | 6.35 | 11.51 | 25.59 |
CV (%) | 6.15 | 4.27 | 4.47 | 6.56 | 5.47 | 3.01 |
The recovery of Human FGF7/KGF spiked at three different levels in samples throughout the range of the assay was evaluated in various matrices.
Sample Type | Range (%) | Average Recovery (%) |
---|---|---|
Serum(n=8) | 94-109 | 101 |
EDTA plasma (n=8) | 94-111 | 102 |
Cell culture media (n=8) | 85-97 | 92 |
Samples were spiked with high concentrations of Human FGF7/KGF and diluted with Reference Standard & Sample Diluent to produce samples with values within the range of the assay.
Database Links | SwissProt:
P21781
|
Synonyms | FGF-7, KGF, HBGF-7 |
Research Area | Cancer, Signal transduction |
1. Add 100μL standard or sample to the wells. Incubate for 90 min at 37°C |
|
2. Discard the liquid, immediately add 100μL Biotinylated Detection Ab working solution to each well. Incubate for 60 min at 37°C |
|
3. Aspirate and wash the plate for 3 times |
|
4. Add 100μL HRP conjugate working solution. Incubate for 30 min at 37°C. Aspirate and wash the plate for 5 times |
|
5. Add 90μL Substrate Reagent. Incubate for 15 min at 37°C |
|
6. Add 50μL Stop Solution |
|
7. Read the plate at 450nm immediately. Calculation of the results |
Sample: Cell culture supernatant |
S***********KSubmitted [ Jun 08 2023 ]
Asked: Hello. i\'m Seong-Ju PARK, Korean researcher I\'m using your kit. There are difficulties in the detection of KGF. * If there is a 6xhis-tag in the KGF c-term, is there no detection? *Can we know the immunogen sequence of plate-coated and bionylated antibodies? ex) QKGIPVRGKKTKKEQKTAHFLPMAIT Thank you!
Reply
adminSubmitted [ Jun 08 2023 ]
Answered: The immunogen of capture antibody and detection antibody of E-EL-H0010 is 32-194 aa (#P21781). The standard is recombinant human FGF7 32-194 aa (#P21781) expressed by E.coli. The immunogen sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT From the description, it looks like you're using recombinant protein, 6xhis-tag in the KGF c-term may result in undetectable situations. The recombinant proteins from different manufacturers may be undetectable due to different expression vectors, sequences, spatial conformation, recognition sites, etc., which may result in our E-EL-H0092 not applicable for your recombinant proteins.