Click here to view cell apoptosis assay products
×

Human FGF7/KGF(Fibroblast Growth Factor 7) ELISA Kit

  • Cat.No.:E-EL-H0092

  • Reactivity: Human

To Purchase E-EL-H0092

Size:
  • 96T
  • 48T
  • 24T
  • 96T*5
  • 96T*10
Price: $609
Qty:

Product Details

Properties

Assay type Sandwich-ELISA
Format 96T/48T
Assay time 3.5h
Detection range 31.25-2000 pg/mL
Sensitivity 18.75 pg/mL
Sample type &Sample volume serum, plasma and other biological fluids; 100μL
Specificity This kit recognizes Human FGF7/KGF in samples. No significant cross-reactivity or interference between Human FGF7/KGF and analogues was observed.
Reproducibility Both intra-CV and inter-CV are < 10%.
Application This ELISA kit applies to the in vitro quantitative determination of Human FGF7/KGF concentrations in serum, plasma and other biological fluids.

Test Principle

This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human FGF7/KGF. Standards or samples are added to the micro ELISA plate wells and combined with the specific antibody. Then a biotinylated detection antibody specific for Human FGF7/KGF and Avidin-Horseradish Peroxidase (HRP) conjugate are added successively to each micro plate well and incubated. Free components are washed away. The substrate solution is added to each well. Only those wells that contain Human FGF7/KGF, biotinylated detection antibody and Avidin-HRP conjugate will appear blue in color. The enzyme-substrate reaction is terminated by the addition of stop solution and the color turns yellow. The optical density (OD) is measured spectrophotometrically at a wavelength of 450 nm ± 2 nm. The OD value is proportional to the concentration of Human FGF7/KGF. You can calculate the concentration of Human FGF7/KGF in the samples by comparing the OD of the samples to the standard curve.

Kit components & Storage

An unopened kit can be stored at 2-8℃ for 1 month. If the kit is not supposed to be used within 1 month, store the components separately according to the following conditions once the kit is received.
ItemSpecificationsStorage
Micro ELISA Plate(Dismountable) 96T: 8 wells ×12 strips
48T: 8 wells ×6 strips
-20℃, 6 months
Reference Standard 96T: 2 vials
48T: 1 vial
Concentrated Biotinylated Detection Ab (100×) 96T: 1 vial, 120 μL
48T: 1 vial, 60 μL
Concentrated HRP Conjugate (100×) 96T: 1 vial, 120 μL
48T: 1 vial, 60 μL
-20℃(Protect from light), 6 months
Reference Standard & Sample Diluent 1 vial, 20 mL 2-8°C, 6 months
Biotinylated Detection Ab Diluent 1 vial, 14 mL
HRP Conjugate Diluent 1 vial, 14 mL
Concentrated Wash Buffer (25×) 1 vial, 30 mL
Substrate Reagent 1 vial, 10 mL 2-8℃(Protect from light)
Stop Solution 1 vial, 10 mL 2-8°C
Plate Sealer 5 pieces
Manual 1 copy
Certificate of Analysis 1 copy

Technical Data

Precision

Intra-assay Precision (Precision within an assay): 3 samples with low, mid range and high level Human FGF7/KGF were tested 20 times on one plate, respectively.
Inter-assay Precision (Precision between assays): 3 samples with low, mid range and high level Human FGF7/KGF were tested on 3 different plates, 20 replicates in each plate.

  Intra-assay Precision Inter-assay Precision
Sample 1 2 3 1 2 3
n 20 20 20 20 20 20
Mean (pg/mL) 100.69 217.61 889.61 96.83 210.35 850.06
Standard deviation 6.19 9.29 39.77 6.35 11.51 25.59
CV (%) 6.15 4.27 4.47 6.56 5.47 3.01

Recovery

The recovery of Human FGF7/KGF spiked at three different levels in samples throughout the range of the assay was evaluated in various matrices.

Sample Type Range (%) Average Recovery (%)
Serum(n=8) 94-109 101
EDTA plasma (n=8) 94-111 102
Cell culture media (n=8) 85-97 92

Linearity

Samples were spiked with high concentrations of Human FGF7/KGF and diluted with Reference Standard & Sample Diluent to produce samples with values within the range of the assay.

Target Information

Database LinksSwissProt:   P21781
SynonymsFGF-7, KGF, HBGF-7
Research AreaCancer, Signal transduction

Assay Procedures

elisa assay procedure 1

1. Add 100μL standard or sample to the wells. Incubate for 90 min at 37°C

elisa assay procedure 2

2. Discard the liquid, immediately add 100μL Biotinylated Detection Ab working solution to each well. Incubate for 60 min at 37°C

elisa assay procedure 3

3. Aspirate and wash the plate for 3 times

elisa assay procedure 4

4. Add 100μL HRP conjugate working solution. Incubate for 30 min at 37°C. Aspirate and wash the plate for 5 times

elisa assay procedure 5

5. Add 90μL Substrate Reagent. Incubate for 15 min at 37°C

elisa assay procedure 6

6. Add 50μL Stop Solution

elisa assay procedure 7

7. Read the plate at 450nm immediately. Calculation of the results

Citations

  1. Experimental and Therapeutic Medicine (2018) IF: 1.41
    Leukocyte depletion does not affect the in vitro healing ability of platelet rich plasma

    DOI: 10.3892/etm.2018.5887

    Sample: Cell culture supernatant

Reviews/Q&A

  • Show all
  • Reviews
  • Q&A
Q

S***********KSubmitted [ Jun 08 2023 ]

Asked: Hello. i\'m Seong-Ju PARK, Korean researcher I\'m using your kit. There are difficulties in the detection of KGF. * If there is a 6xhis-tag in the KGF c-term, is there no detection? *Can we know the immunogen sequence of plate-coated and bionylated antibodies? ex) QKGIPVRGKKTKKEQKTAHFLPMAIT Thank you!

Reply

A

adminSubmitted [ Jun 08 2023 ]

Answered: The immunogen of capture antibody and detection antibody of E-EL-H0010 is 32-194 aa (#P21781). The standard is recombinant human FGF7 32-194 aa (#P21781) expressed by E.coli. The immunogen sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT From the description, it looks like you're using recombinant protein, 6xhis-tag in the KGF c-term may result in undetectable situations. The recombinant proteins from different manufacturers may be undetectable due to different expression vectors, sequences, spatial conformation, recognition sites, etc., which may result in our E-EL-H0092 not applicable for your recombinant proteins.

... Show All Show Less

People Also Bought

Apply for Free Shipping 24T ELISA Kit
*Product Name:
*Catalog Number:
Size:
*Name:
*Email:
*Phone:
*Message:
*Country:
*When will you use it?

*Captcha: