Sequence (One Letter Code)	DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: C5-C34, C12-C27, C17-C35)
Sequence (Three Letter Code)	Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys (Disulfide bridges: Cys5-Cys34, Cys12-Cys27, Cys17-Cys35)
Formula	C167H256N48O50S6
Molecular Weight	3928.58
Form	Lyophilized powder
Purity	> 95%
Storage	Shipped at 4℃. Stored at -20℃ for one year.
Note	For research use only.

... Show All Show Less

Contact

*Product Name:
*Catalog Number:
*Name:
*Email:
*Message:
*Country:
*When will you use it?	Within 1 month In 2 to 3 month In 4 to 6 month 6 months later
*Captcha:	Click to load Captcha

┒-Defensin-1, human

Cat. No	E-PP-0395
Application