Click here to view cell apoptosis assay products

Current Position:Home>>Protein Products>>Peptides>> β-Amyloid Peptide (1-42), rat

β-Amyloid Peptide (1-42), rat

    • Peptide products for various applications-Elabscience
    <
    >
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-0459

      Size:
      • 1 mg
      • 5 mg
      • 10 mg
      Qty:
      - +
      Price: Inquire

      Formula: C199H307N53O59S

      Molecular Weight: 4418.05 Da

      Lead Time:InquiryWelcome to order from local distributors.

      Add to cart Compare Bulk request
      Download

      Product information

      Sequence (One Letter Code) DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
      Sequence (Three Letter Code) Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
      Formula C199H307N53O59S
      Molecular Weight 4418.05
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      • Show all (1)
      • Reviews (0)
      • Q&A (1)
      Q

      A*******aSubmitted [ Dec 14 2022 ]

      Asked: We bought β-Amyloid Peptide (1-42), rat e-pp-0459. But we need information about pre-incubation after dissolve on dmso. Do we need to pre-incubate in 37C and how pond time? And only dmso is good for prepare solution? Best regards, Anastasia

      Reply

      A

      adminSubmitted [ Dec 14 2022 ]

      Answered: 1mg polypeptide can be completely dissolved in 1mL recommended solvent. For further requirements on peptide dissolving conditions, please select 'Peptide Solubility Test Service'.

      ... Show All Show Less

      Antibodies Promotion

      Contact

      Contact us Distributors
      MSDS for ELISA ISO 9001

      Browsing History


        People Also Bought

        About Us

        Company Information

        Distributors

        Contact us

        News

        Return and Refund Policy

        dhl Fedex
        Terms and Conditions | Privacy Policy | Cookie Policy  ©2009-2024Elabscience Bionovation Inc. All Rights Reserved.
        鄂ICP备18003807号-3
        We use cookies to improve your browsing experience, serve personalized ads or content, and for analytics and metrics about our visitors both on this website and other media. By clicking "Accept All", you consent to our use of cookies. To find out more about the cookies we use, see our Cookie Policy
        Accept All Reject All
        Apply for
        *Product Name:
        *Catalog Number:
        *Name:
        *Email:
        *Message:
        *Country:
        *When will you use it?

        *Captcha:
        Click to load Captcha