Click here to view cell apoptosis assay products

Calcitonin, human

    • Peptide products for various applications-Elabscience
    <
    >
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-0900

      Size:
      • 1 mg
      • 5 mg
      • 10 mg
      Qty:
      - +
      Price: Inquire

      Formula: C151H226N40O45S3

      Molecular Weight: 3417.87 Da

      Lead Time:InquiryWelcome to order from local distributors.

      Add to cart Compare Bulk request

      Product information

      Sequence (One Letter Code) CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: C1-C7)
      Sequence (Three Letter Code) Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
      Formula C151H226N40O45S3
      Molecular Weight 3417.87
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      • Show all (0)
      • Reviews (0)
      • Q&A (0)
      ... Show All Show Less
      MSDS for ELISA ISO 9001

      Browsing History


        People Also Bought

        Apply for
        *Product Name:
        *Catalog Number:
        *Name:
        *Email:
        *Message:
        *Country:
        *When will you use it?

        *Captcha: