Sequence (One Letter Code)	ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (all D amino acid)
Sequence (Three Letter Code)	D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly
Formula	C228H388N86O64
Molecular Weight	5358.05
Form	Lyophilized powder
Purity	> 95%
Storage	Shipped at 4℃. Stored at -20℃ for one year.
Note	For research use only.

... Show All Show Less

Contact

*Product Name:
*Catalog Number:
*Name:
*Email:
*Message:
*Country:
*When will you use it?	Within 1 month In 2 to 3 month In 4 to 6 month 6 months later
*Captcha:	Click to load Captcha

FOXO4 D-Retro-Inverso(DRI) peptide

Cat. No	E-PP-2108
Application