Current Position:Home>>Protein Products>>Peptides>> mCRAMP, mouse
Catalog number:E-PP-1525
Formula: C₁₇₈H₃₀₂N₅₀O₄₆
Molecular Weight: 3878.7 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
Sequence (Three Letter Code) | Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln |
Formula | C₁₇₈H₃₀₂N₅₀O₄₆ |
Molecular Weight | 3878.7 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |