Current Position:Home>>Protein Products>>Peptides>> Oxyntomodulin, human, mouse, rat
Catalog number:E-PP-1670
Formula: C₁₉₂H₂₉₅N₆₁O₆₀S
Molecular Weight: 4449.93 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
Sequence (Three Letter Code) | His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala |
Formula | C₁₉₂H₂₉₅N₆₁O₆₀S |
Molecular Weight | 4449.93 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |