Urodilatin CCC/ANP-95-126

Name: Urodilatin CCC/ANP-95-126
Brand: Elabscience
SKU: E-PP-2055
Availability: InStock

Catalog number:E-PP-2055

Size:

Qty:

- +

Price: Inquire

Formula: C145H234N52O44S3

Molecular Weight: 3506 Da

Lead Time:InquiryWelcome to order from local distributors.

Add to cart Compare Bulk request

Download

Sequence (One Letter Code)	TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfide bridge: Cys11- Cys27)
Sequence (Three Letter Code)	Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge: Cys11- Cys27)
Formula	C145H234N52O44S3
Molecular Weight	3506
Form	Lyophilized powder
Purity	> 95%
Storage	Shipped at 4℃. Stored at -20℃ for one year.
Note	For research use only.

... Show All Show Less

Contact

*Product Name:
*Catalog Number:
*Name:
*Email:
*Message:
*Country:
*When will you use it?	Within 1 month In 2 to 3 month In 4 to 6 month 6 months later
*Captcha:	Click to load Captcha

Cat. No	E-PP-2055
Application