Urodilatin CCC/ANP-95-126

Name: Urodilatin CCC/ANP-95-126
Brand: Elabscience
SKU: E-PP-2055
Availability: InStock

Catalog number:E-PP-2055

Size:

Qty:

- +

Price: Inquire

Formula: C₁₄₅H₂₃₄N₅₂O₄₄S₃

Molecular Weight: 3506 Da

Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.

Add to cart Compare Bulk request Manual

Sequence (One Letter Code)	TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfide bridge: Cys11- Cys27)
Sequence (Three Letter Code)	Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge: Cys11- Cys27)
Formula	C₁₄₅H₂₃₄N₅₂O₄₄S₃
Molecular Weight	3506
Form	Lyophilized powder
Purity	> 95%
Storage	Shipped at 4℃. Stored at -20℃ for one year.
Note	For research use only.

... Show All Show Less

Contact

*Product Name:
*Catalog Number:
Size:
*Name:
*Email:
*Phone:
*Message:
*Country:
How do you know Elabscience:	Email Distributor Search engine Advertisement Others
*Verification code:	Click to load Captcha

Cat. No	E-PP-2055
Application