Urodilatin CCC/ANP-95-126

    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-2055

      • 1 mg
      - +
      Price: Inquire

      Formula: C₁₄₅H₂₃₄N₅₂O₄₄S₃

      Molecular Weight: 3506 Da

      Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.

      Add to cart Compare Bulk request Manual

      Product information

      Sequence (One Letter Code) TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfide bridge: Cys11- Cys27)
      Sequence (Three Letter Code) Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge: Cys11- Cys27)
      Formula C₁₄₅H₂₃₄N₅₂O₄₄S₃
      Molecular Weight 3506
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      submit review
      • Show all (0)
      • Reviews (0)
      • Q&A (0)
      ... Show All Show Less
      MSDS for ELISA ISO 9001

      Browsing History

        People Also Bought

        Apply for Free Shipping 24T ELISA Kit
        *Product Name:
        *Catalog Number:
        How do you know

        *Verification code: