Facebook
Toll-free:1-888-852-8623

All categories

  • All categories
  • Flow Cytometry Antibodies
  • ELISA Kits
  • MACS Cell Isolation
  • Antibodies and Reagents
  • Apoptosis and Cell Health Detection
  • Metabolism Assays
  • Immunoassays
  • Cell Identification Kits
  • Proteins and Peptides
  • Cell Culture
Please enter the item number/product keyword!
Keyword cannot be empty !
INSERT SYMBOLS:
  • α
  • β
  • γ
  • δ
  • ε
  • ζ
  • η
  • θ
  • κ
  • μ
  • ω
  • σ
  • τ
  • λ
  • ⅩⅢ
  • ⅩⅢ
  • ⅩⅣ
  • ⅩⅤ
  • ⅩⅦ
  • ⅩⅧ
  • UP ↑

Recombinant Swine GM-CSF protein(His Tag) (PKSS000024)

All Size Price Qty
20μg $ 358.00
5μg $ 158.00
Add to cart

For research use only.

Synonyms CSF2
Species Porcine
Expression Host E.coli
Sequence MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK
Accession Q29118
Calculated Molecular Weight 17.1 kDa
Tag N-His
Bio-activity Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 3 ng/mL.
Form Lyophilized powder
Purity > 98 % as determined by reducing SDS-PAGE.
Endotoxin Please contact us for more information.
Storage Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping This product is provided as lyophilized powder which is shipped with ice packs.
Formulation Lyophilized from sterile PBS, pH 7.4
Normally 5% - 8% trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution Please refer to the printed manual for detailed information.
Background Granulocyte-macrophage colony-stimulating factor (GM-CSF) is one of an array of cytokines with pivotal roles in embryo implantation and subsequent development. Several cell lineages in the reproductive tract and gestational tissues synthesise GM-CSF under direction by ovarian steroid hormones and signalling agents originating in male seminal fluid and the conceptus. The pre-implantation embryo, invading placental trophoblast cells and the abundant populations of leukocytes controlling maternal immune tolerance are all subject to GM-CSF regulation. GM-CSF stimulates the differentiation of hematopoietic progenitors to monocytes and neutrophils, and reduces the risk for febrile neutropenia in cancer patients. GM-CSF also has been shown to induce the differentiation of myeloid dendritic cells (DCs) that promote the development of T-helper type 1 immune responses in cognate T cells. As a part of the immune/inflammatory cascade, GM-CSF promotes Th1 biased immune response, angiogenesis, allergic inflammation, and the development of autoimmunity, and thus worthy of consideration for therapeutic target. GM-CSF has been utilized in the clinical management of multiple disease processes. Most recently, GM-CSF has been incorporated into the treatment of malignancies as a sole therapy, as well as a vaccine adjuvant. While the benefits of GM-CSF in this arena have been promising, recent reports have suggested the potential for GM-CSF to induce immune suppression and, thus, negatively impact outcomes in the management of cancer patients.
Other Clones

{{antibodyDetailsPage.numTotal}} Results

Other Formats

{{formatDetailsPage.numTotal}} Results

  • IF:{{item.impact}}

    Journal:{{item.journal}} ({{item.year}})

    DOI:{{item.doi}}

    Reactivity:{{item.species}}

    Sample Type:{{item.organization}}

  • Q{{(FAQpage.currentPage - 1)*pageSize+index+1}}:{{item.name}}

Product Information