Sequence (One Letter Code)	STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: C4-C9 )
Sequence (Three Letter Code)	Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9 )
Formula	C194H304N58O59S4
Molecular Weight	4521.2
Form	Lyophilized powder
Purity	> 95%
Storage	Shipped at 4℃. Stored at -20℃ for one year.
Note	For research use only.

... Show All Show Less

Contact

*Product Name:
*Catalog Number:
*Name:
*Email:
*Message:
*Country:
*When will you use it?	Within 1 month In 2 to 3 month In 4 to 6 month 6 months later
*Captcha:	Click to load Captcha

Adrenomedullin (11-50), rat

Cat. No	E-PP-0621
Application