Charybdotoxin

    • Peptide products for various applications-Elabscience
    <
    >
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-0965

      Size:
      • 1 mg
      • 5 mg
      • 10 mg
      Qty:
      - +
      Price: Inquire

      Formula: C₁₇₆H₂₇₇N₅₇O₅₅S₇

      Molecular Weight: 4295.98 Da

      Lead Time: 7~10 daysWelcome to order from local distributors.

      Add to cart Compare Bulk request Manual

      Product information

      Sequence (One Letter Code) (Glp)-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridges: C7-C28, C13-C33, C17-C35 )
      Sequence (Three Letter Code) Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridges: Cys7-Cys28, Cys13-Cys33, Cys17-Cys35 )
      Formula C₁₇₆H₂₇₇N₅₇O₅₅S₇
      Molecular Weight 4295.98
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      submit review
      • Show all (0)
      • Reviews (0)
      • Q&A (0)
      ... Show All Show Less
      MSDS for ELISA ISO 9001

      Browsing History


        People Also Bought

        Apply for 24T ELISA Kit
        *Product Name:
        *Catalog Number:
        Size:
        *Name:
        *Email:
        *Phone:
        *Message:
        *Country:
        How do you know
        Elabscience:

        *Verification code: