Sequence (One Letter Code)	(Glp)-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridges: C7-C28, C13-C33, C17-C35 )
Sequence (Three Letter Code)	Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridges: Cys7-Cys28, Cys13-Cys33, Cys17-Cys35 )
Formula	C176H277N57O55S7
Molecular Weight	4295.98
Form	Lyophilized powder
Purity	> 95%
Storage	Shipped at 4℃. Stored at -20℃ for one year.
Note	For research use only.

... Show All Show Less

Contact

*Product Name:
*Catalog Number:
*Name:
*Email:
*Message:
*Country:
*When will you use it?	Within 1 month In 2 to 3 month In 4 to 6 month 6 months later
*Captcha:	Click to load Captcha

Charybdotoxin

Cat. No	E-PP-0965
Application