Current Position:Home>>Protein Products>>Peptides>> Fibronectin-Binding Protein
Catalog number:E-PP-1145
Formula: C190H283N49O66
Molecular Weight: 4309.66 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV |
Sequence (Three Letter Code) | Phe-Asn-Lys-His-Thr-Glu-Ile-Ile-Glu-Glu-Asp-Thr-Asn-Lys-Asp-Lys-Pro-Ser-Tyr-Gln-Phe-Gly-Gly-His-Asn-Ser-Val-Asp-Phe-Glu-Glu-Asp-Thr-Leu-Pro-Lys-Val |
Formula | C190H283N49O66 |
Molecular Weight | 4309.66 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |