Galanin-Lys(Biotin), human

    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-1175

      • 1 mg
      • 5 mg
      • 10 mg
      - +
      Price: Inquire

      Formula: C155H237N46O46S

      Molecular Weight: 3511.95 Da

      Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.

      Add to cart Compare Bulk request Manual

      Product information

      Sequence (One Letter Code) GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
      Sequence (Three Letter Code) Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin)
      Formula C155H237N46O46S
      Molecular Weight 3511.95
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      submit review
      • Show all (0)
      • Reviews (0)
      • Q&A (0)
      ... Show All Show Less
      MSDS for ELISA ISO 9001

      Browsing History

        People Also Bought

        Apply for Free Shipping 24T ELISA Kit
        *Product Name:
        *Catalog Number:
        How do you know

        *Verification code: