Current Position:Home>>Protein Products>>Peptides>> GLP-2 (1-33), human
Catalog number:E-PP-1214
Formula: C₁₆₅H₂₅₄N₄₄O₅₅S
Molecular Weight: 3766.2 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | HADGSFSDEMNTILDNLAARDFINWLIQTKITD |
Sequence (Three Letter Code) | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
Formula | C₁₆₅H₂₅₄N₄₄O₅₅S |
Molecular Weight | 3766.2 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |