Current Position:Home>>Protein Products>>Peptides>> Glucagon-Like Peptide 1,(GLP-1), amide, human
Catalog number:E-PP-1219
Formula: C₁₈₄H₂₇₃N₅₁O₅₇
Molecular Weight: 4111.53 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
Sequence (Three Letter Code) | His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
Formula | C₁₈₄H₂₇₃N₅₁O₅₇ |
Molecular Weight | 4111.53 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |