Current Position:Home>>Protein Products>>Peptides>> Parathyroïd Hormone(1-34), bovine
Catalog number:E-PP-1728
Formula: C₁₈₃H₂₈₈N₅₄O₅₀S₂
Molecular Weight: 4108.7 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF |
Sequence (Three Letter Code) | Ala-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe |
Formula | C₁₈₃H₂₈₈N₅₄O₅₀S₂ |
Molecular Weight | 4108.7 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |