Click here to view cell apoptosis assay products

Parathyroid Hormone (1-34)-Lys(Biotin), human

    • Peptide products for various applications-Elabscience
    <
    >
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-1731

      Size:
      • 1 mg
      • 5 mg
      • 10 mg
      Qty:
      - +
      Price: Inquire

      Formula: C197H317N59O54S3

      Molecular Weight: 4472.26 Da

      Lead Time:InquiryWelcome to order from local distributors.

      Add to cart Compare Bulk request

      Product information

      Sequence (One Letter Code) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
      Sequence (Three Letter Code) Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Lys(Biotin)
      Formula C197H317N59O54S3
      Molecular Weight 4472.26
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      • Show all (0)
      • Reviews (0)
      • Q&A (0)
      ... Show All Show Less
      MSDS for ELISA ISO 9001

      Browsing History


        People Also Bought

        Apply for
        *Product Name:
        *Catalog Number:
        *Name:
        *Email:
        *Message:
        *Country:
        *When will you use it?

        *Captcha: