Current Position:Home>>Protein Products>>Peptides>> Prolactin Releasing Peptide (1-31), HumanPrRP-31
Catalog number:E-PP-1821
Formula: C₁₆₀H₂₅₂N₅₆O₄₂S
Molecular Weight: 3664.2 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 |
Sequence (Three Letter Code) | Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
Formula | C₁₆₀H₂₅₂N₅₆O₄₂S |
Molecular Weight | 3664.2 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |