Click here to view cell apoptosis assay products

Current Position:Home>>Protein Products>>Peptides>> pTH-Related Protein Splice Isoform 3 (140-173), human

pTH-Related Protein Splice Isoform 3 (140-173), human

    • Peptide products for various applications-Elabscience
    <
    >
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-1847

      Size:
      • 1 mg
      • 5 mg
      • 10 mg
      Qty:
      - +
      Price: Inquire

      Formula: C186H313N53O44S2

      Molecular Weight: 4059.99 Da

      Lead Time:InquiryWelcome to order from local distributors.

      Add to cart Compare Bulk request
      Download

      Product information

      Sequence (One Letter Code) TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL
      Sequence (Three Letter Code) Thr-Ala-Leu-Leu-Trp-Gly-Leu-Lys-Lys-Lys-Lys-Glu-Asn-Asn-Arg-Arg-Thr-His-His-Met-Gln-Leu-Met-Ile-Ser-Leu-Phe-Lys-Ser-Pro-Leu-Leu-Leu-Leu
      Formula C186H313N53O44S2
      Molecular Weight 4059.99
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      • Show all (0)
      • Reviews (0)
      • Q&A (0)
      ... Show All Show Less

      Antibodies Promotion

      Contact

      Contact us Distributors
      MSDS for ELISA ISO 9001

      Browsing History


        People Also Bought

        About Us

        Company Information

        Distributors

        Contact us

        News

        Return and Refund Policy

        dhl Fedex
        Terms and Conditions | Privacy Policy | Cookie Policy  ©2009-2024Elabscience Bionovation Inc. All Rights Reserved.
        鄂ICP备18003807号-3
        We use cookies to improve your browsing experience, serve personalized ads or content, and for analytics and metrics about our visitors both on this website and other media. By clicking "Accept All", you consent to our use of cookies. To find out more about the cookies we use, see our Cookie Policy
        Accept All Reject All
        Apply for
        *Product Name:
        *Catalog Number:
        *Name:
        *Email:
        *Message:
        *Country:
        *When will you use it?

        *Captcha:
        Click to load Captcha