Current Position:Home>>Protein Products>>Recombinant Proteins>> Recombinant Swine GM-CSF protein(His Tag)
Cat.No.:PKSS000024
Welcome to order from local distributors.
Add to cart Bulk request
For research use only. Order now, ship in 3 days
Synonyms | CSF2 |
Species | Porcine |
Expression_host | E.coli |
Sequence | MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK |
Accession | Q29118 |
Mol_Mass | 17.1 kDa |
Tag | N-His |
Bio_Activity | Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 3 ng/mL. |
Purity | > 98 % as determined by reducing SDS-PAGE. |
Endotoxin level | Please contact us for more information. |
Storage | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. |
Shipping | This product is provided as lyophilized powder which is shipped with ice packs. |
Formulation | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
Reconstitution | Please refer to the printed manual for detailed information. |