Current Position:Home>>Protein Products>>Peptides>> Steroidogenesis-Activator Polypeptide, rat
Catalog number:E-PP-1960
Formula: C₁₄₁H₂₂₆N₃₄O₅₁
Molecular Weight: 3213.54 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | IVQPIISKLYGSGGPPPTGEEDTDEKKDEL |
Sequence (Three Letter Code) | Ile-Val-Gln-Pro-Ile-Ile-Ser-Lys-Leu-Tyr-Gly-Ser-Gly-Gly-Pro-Pro-Pro-Thr-Gly-Glu-Glu-Asp-Thr-Asp-Glu-Lys-Lys-Asp-Glu-Leu |
Formula | C₁₄₁H₂₂₆N₃₄O₅₁ |
Molecular Weight | 3213.54 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |