Add to cart
For research use only.
| Sequence (One Letter Code) | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: C2-C7) |
| Sequence (Three Letter Code) | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7) |
| Calculated Molecular Weight | 3918.47 |
| Molecular Formula | C167H270N52O53S2 |
| Form | Lyophilized powder |
| Purity | > 95% |
| Storage | -20℃ |
| Shipping | ice bag |
| Note | For research use only. |
-
IF:{{item.impact}}
Journal:{{item.journal}} ({{item.year}})
DOI:{{item.doi}}Reactivity:{{item.species}}
Sample Type:{{item.sample_type}}
-
Q{{(FAQpage.currentPage - 1)*pageSize+index+1}}:{{item.name}}
No files available. Please enter the correct identification code in the search area to query the relevant documents.
| Title | Status | Valid until | Action | |
|---|---|---|---|---|
| {{v.文件名}} | {{v.status_str}} | {{v.timestamp_str}} | Download | / |
*Note:Please download the relevant files within the validity period. After expiration, file preview and download will not be available on the page.

