Facebook
Toll-free:1-888-852-8623

All categories

  • All categories
  • Flow Cytometry Antibodies
  • Immunoassays
  • Antibodies and Reagents
  • Apoptosis and Cell Health Detection
  • Metabolism Assays
  • Cell Isolation Products
  • Cell Identification Kits
  • Proteins and Peptides
  • Cell Culture
Please enter the item number/product keyword!
Keyword cannot be empty !
INSERT SYMBOLS:
  • α
  • β
  • γ
  • δ
  • ε
  • ζ
  • η
  • θ
  • κ
  • μ
  • ω
  • σ
  • τ
  • λ
  • ⅩⅢ
  • ⅩⅢ
  • ⅩⅣ
  • ⅩⅤ
  • ⅩⅦ
  • ⅩⅧ
  • UP ↑

Calcitonin Gene Related Peptide II, human (E-PP-0908)

Calcitonin Gene Related Peptide II, human - 1
  • Calcitonin Gene Related Peptide II, human - 1
All Size Price Qty
5mg Inquire /
2mg Inquire /
1mg Inquire /
Add to cart

For research use only.

Sequence (One Letter Code) ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge: C2-C7)
Sequence (Three Letter Code) Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (Disulfide bridge: Cys2-Cys7)
Calculated Molecular Weight 3793.38
Molecular Formula C162H267N51O48S3
Form Lyophilized powder
Purity > 95%
Storage -20℃
Shipping ice bag
Note For research use only.
Cat.No. Product Name Clone No.
  • IF:{{item.impact}}

    Journal:{{item.journal}} ({{item.year}})

    DOI:{{item.doi}}

    Reactivity:{{item.species}}

    Sample Type:{{item.sample_type}}

  • Q{{(FAQpage.currentPage - 1)*pageSize+index+1}}:{{item.name}}

Product Information
确定