MYH7 Polyclonal Antibody

Uniprot : P12883
  • Cat.No.:E-AB-62836

  • Host: Rabbit
  • Reactivity: M,R
  • Applications: WB,IHC,IF

To Purchase E-AB-62836

Size:
  • 60μL
  • 120μL
  • 200μL
Price: $129
Qty:

Test Application

  • Verified Samples

    Reactivity Application
    Rat WB
    (heart,lung,heart,)

    Western blot analysis of extracts of rat heart using MYH7 Polyclonal Antibody at dilution of 1:1000.

    Western blot analysis of extracts of various cell lines using MYH7 Polyclonal Antibody at dilution of 1:1000.

    Western blot analysis of extracts of various cell lines using MYH7 Polyclonal Antibody at dilution of 1:1000.

    IF
    (skeletal muscle,)

    Immunofluorescence analysis of Rat skeletal muscle using MYH7 Polyclonal Antibody at dilution of 1:100.Blue: DAPI for nuclear staining.

    Mouse WB
    (brain,)

    Western blot analysis of extracts of various cell lines using MYH7 Polyclonal Antibody at dilution of 1:1000.

    IHC
    (skeletal muscle,heart,)

    Immunohistochemistry of paraffin-embedded Mouse skeletal muscle using MYH7 Polyclonal Antibody at dilution of 1:100 (40x lens).

    Immunohistochemistry of paraffin-embedded Mouse heart using MYH7 Polyclonal Antibody at dilution of 1:100 (40x lens).

  • Dilution

    WB 1:500-1:2000 IHC 1:50-1:100 IF 1:50-1:200

Preparation of protein samples

1.Protein extraction

1)For tissue sample
a. Take the samples, wash the tissue thoroughly with pre-cooled PBS (0.01 M, pH=7.4)(Cat# E-BC-R187) to remove the surface blood and internal debris.
b. Weigh and smash the tissue, add an appropriate ratio of RIPA Lysis Buffer (Cat# E-BC-R327)(add 10 μL PMSF and 10 μL Na3VO4 to each 1 mL RIPA Lysis) and homogenizely lyse the tissue.
It is recommended to homogenize according to the ratio of tissue weight: RIPA volume = 3:10. For example, add 1 mL RIPA Lysis Buffer to 0.3 g tissue sample, the specific volume can be adjusted according to experimental requirements.
c. Shake and lyse on the ice for 30 min after homogenization. And then sonicate the sample for 1 min (under ice water bath conditions) with 2 s’ sonication and 2 s’ intervals to make cells fully lysis and reduce the viscosity of sample.
d. Centrifuge at 12,000 rpm for 10 min at 4℃.
e. Take the supernatant and measure the protein concentration mentioned in step2.

2)For cell sample
a. Collect the cells, wash them thoroughly with pre-cooled PBS (0.01 M, pH=7.4) to remove the medium off (it is generally recommended to wash 3 times).
b. Add an appropriate ratio of RIPA Lysate Buffer (10 μL PMSF and 10 μL Na3VO4 in each 1 mL RIPA Lysis) and lyse on the ice for 30 min.
It is recommended to add 0.1 mL of RIPA Lysis Buffer to each well of a 6-well plates (the protein content in different cells may vary, and the volume of the lysate added can be appropriately adjusted).
c. Sonicate the sample for 1 min (under ice water bath conditions) with 2 s’ sonication and 2 s’ intervals to make cells fully lyse and reduce viscosity of sample.
d. Centrifuge at 12,000 rpm for 10 min at 4℃.
e. Take the supernatant and measure the protein concentration mentioned in step2.

2.Measurement of protein concentration
By the BCA method (see the Total Protein Colorimetric Assay Kit (Cat# E-BC-K318) instructions).

3.Boiling the samples
Adjust the protein concentration with PBS Buffer. Add 5 × SDS Loading Buffer (Cat# E-BC-R288) with the ratio of the protein sample: 5 × SDS Loading Buffer = 4:1 and boil the mixture for 10 min. Centrifuge at 12,000 rpm for 2 min and collect the supernatant. The denatured protein can be employed to Western Blot experiments or stored at -20℃ or -80℃.

Note: It is recommended that the total protein loading amount of test sample is about 50 μg in each well. Try to make the loading volume of each sample close to 10 μL.

Electrophoresis

1.According to the molecular weight of the target protein, prepare 0% separation gel. Add the test sample to each well, and add 5 μL of Pre-stained Protein Marker (Cat# E-BC-R273)to a reserved well in order to verify the target molecular weight and the extent of membrane transfer. Add Electrophoresis Buffer ( Cat# E-BC-R331) and start electrophoresis.

2.Electrophoresis at 80v when the samples are in stacking gel, then convert to 120v when the blue flow into the separating gel. Electrophoresis time is about 2-3 h till bromophenol blue reaches the bottom of the gel.

Transfer Membrane (Wet transfer)

1.Choose the PVDF Membrane (Cat# ) with a pore size of μm according to the molecular weight of the target protein. Soak the PVDF Membrane in methanol for 1 min to activate it, and then soak the PVDF Membrane in the Transmembrane Buffer (Cat# E-BC-R333), the filter paper and fiber mat must be soaked in the Transmembrane Buffer for use too.

2.Place the following materials in the order of the black plate (negative electrode) - fiber mat - filter paper - gel - PVDF Membrane - filter paper - fiber mat - white plate (positive electrode) are placed in order, discharge bubbles, clamp and place in the wet transfer tank. The recommended transmembrane conditions are . Make sure that the transmembrane process is carried out at low temperatures.
Note: This is for wet transfer. If other transmembrane methods are used, please adjust according to the specific conditions.

3.After the transmembrane, take out the PVDF Membrane carefully and wash with TBST Buffer for 1 min.

Incubation of antibodies

1.Soak the PVDF Membrane with TBST Buffer (Cat# E-BC-R335) containing 5% Skim Milk Powder as blocking buffer and block the membrane at room temperature for .

2.According to the recommended primary antibody dilution ratio, use the TBST Buffer containing 5% Skim Milk Powder to dilute the MYH7 Antibody at , soak the PVDF Membrane in the primary antibody working solution, incubate overnight at 4 ℃, and gently shake.

3.Wash the PVDF Membrane with TBST Buffer for .

4.According to the recommended secondary antibody dilution ratio, use a TBST Buffer solution containing 2% Skim Milk Powder to dilute Goat Anti-Rabbit IgG (H+L) (peroxidase/HRP conjugated) (Cat# E-AB-1003) at . Incubate at room temperature for 1 h on a shaker.

5.Wash the PVDF Membrane with TBST Buffer for .

Detection

1.Mix A and B in the Excellent Chemiluminescent Substrate Detection kit (Cat# E-BC-R347) at the ratio of 1:1 as working solution.

2.Take out the PVDF Membrane from TBST Buffer and absorb the liquid with the filter paper. Pave the PVDF Membrane on the detection machine, add ECL working solution continuously on the PVDF Membrane, discharge the bubble and detect the result.

3.Adjust the contrast and the exposure time to get the best image.

Appendix

Product Details

Isotype IgG
Concentration 1mg/mL
Storage Store at -20°C. Avoid freeze / thaw cycles.
Buffer PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Purification Method Affinity purification
Research Areas Cancer, Cardiovascular, Developmental Biology, Signal Transduction, Stem Cells
Conjugation Unconjugated

Immunogen Details

Immunogen Recombinant fusion protein of human MYH7 (NP_000248.2).
Abbre MYH7
Synonyms MYH7,CMD1S,CMH1,MPD1,MYHCB,SPMD,SPMM,myosin-7,MYH7
Swissprot P12883
Gene ID 4625
Calculated MW 223kDa
Observed MW 223kDa
Cellular Localization Cytoplasm>myofibril. Thick filaments of the myofibrils.
Tissue Specificity Both wild type and variant Gln-403 are detected in skeletal muscle (at protein level).

Background

Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy.

Reviews/Q&A

  • Show all
  • Reviews
  • Q&A
Q

m**************aSubmitted [ Aug 27 2018 ]

Asked: If this antibody is consisted of peptide,tell me about the sequence of antigen. Ex) MYH7 antigen→MLVGAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLY

Reply

A

Y**iSubmitted [ Aug 27 2018 ]

Answered: Hello,Kazumasa,thanks for your inquiry,this is Yumi. E-AB-62836 MYH7 Polyclonal Antibody Recombinant fusion protein containing a sequence corresponding to amino acids 1766-1935 of human MYH7 AEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSRDIGTKGLNEE If any question,please feel free to contact me.My email is yumi@elabscience.com. Best regards,

... Show All Show Less

People Also Bought

Apply for 10 Test Free Trial FCM Antibody
*Product Name:
*Catalog Number:
*Name:
*Email:
*Message:
*Country:
How do you know
Elabscience:

*Captcha: