Current Position:Home>>Protein Products>>Peptides>> GIP (1-30), porcine, amide
Catalog number:E-PP-1206
Formula: C162H245N41O47S
Molecular Weight: 3551.07 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2 |
Sequence (Three Letter Code) | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 |
Formula | C162H245N41O47S |
Molecular Weight | 3551.07 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |