GRF, free acid, human

    • Peptide products for various applications-Elabscience
    <
    >
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-1252

      Size:
      • 1 mg
      • 5 mg
      • 10 mg
      Qty:
      - +
      Price: Inquire

      Formula: C215H357N71O67S

      Molecular Weight: 5040.74 Da

      Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.

      Add to cart Compare Bulk request Manual

      Product information

      Sequence (One Letter Code) YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
      Sequence (Three Letter Code) Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu
      Formula C215H357N71O67S
      Molecular Weight 5040.74
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      submit review
      • Show all (0)
      • Reviews (0)
      • Q&A (0)
      ... Show All Show Less
      MSDS for ELISA ISO 9001

      Browsing History


        People Also Bought

        Apply for Free Shipping 24T ELISA Kit
        *Product Name:
        *Catalog Number:
        Size:
        *Name:
        *Email:
        *Phone:
        *Message:
        *Country:
        How do you know
        Elabscience:

        *Verification code: