Current Position:Home>>Protein Products>>Peptides>> IL-1b (208-240), human
Catalog number:E-PP-1372
Formula: C₁₉₁H₂₉₂N₄₈O₅₁S
Molecular Weight: 4108.81 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | KKKMEKRFVFNKIEINNKLEFESAQFPNWYIST |
Sequence (Three Letter Code) | Lys-Lys-Lys-Met-Glu-Lys-Arg-Phe-Val-Phe-Asn-Lys-Ile-Glu-Ile-Asn-Asn-Lys-Leu-Glu-Phe-Glu-Ser-Ala-Gln-Phe-Pro-Asn-Trp-Tyr-Ile-Ser-Thr |
Formula | C₁₉₁H₂₉₂N₄₈O₅₁S |
Molecular Weight | 4108.81 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |