Neuropeptide EI-Gly-Arg-Arg-MCH, human, mouse, rat

    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-1605

      • 1 mg
      • 5 mg
      • 10 mg
      - +
      Price: Inquire

      Formula: C182H282N54O52S4

      Molecular Weight: 4186.86 Da

      Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.

      Add to cart Compare Bulk request Manual

      Product information

      Sequence (One Letter Code) EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV (Disulfide bridge: C23-C32)
      Sequence (Three Letter Code) Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-Gly-Arg-Arg-Asp-Phe-Asp-Met-Leu-Arg-Cys-Met-Leu-Gly-Arg-Val-Tyr-Arg-Pro-Cys-Trp-Gln-Val (Disulfide bridge: C23-C32)
      Formula C182H282N54O52S4
      Molecular Weight 4186.86
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      submit review
      • Show all (0)
      • Reviews (0)
      • Q&A (0)
      ... Show All Show Less
      MSDS for ELISA ISO 9001

      Browsing History

        People Also Bought

        Apply for
        *Product Name:
        *Catalog Number:
        How do you know
