Current Position:Home>>Protein Products>>Peptides>> VIP, human, porcine, rat; VIP (28 amino acids)
Catalog number:E-PP-2076
Formula: C₁₄₇H₂₃₈N₄₄O₄₂S
Molecular Weight: 3225.7 Da
Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.
Add to cart Compare Bulk request ManualSequence (One Letter Code) | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
Sequence (Three Letter Code) | His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 |
Formula | C₁₄₇H₂₃₈N₄₄O₄₂S |
Molecular Weight | 3225.7 |
Form | Lyophilized powder |
Purity | > 95% |
Storage | Shipped at 4℃. Stored at -20℃ for one year. |
Note | For research use only. |