Helospectin I

    • Peptide products for various applications-Elabscience
    <
    >
    • Peptide products for various applications-Elabscience
    • Peptide products for various applications-Elabscience

      Catalog number:E-PP-1286

      Size:
      • 1 mg
      • 5 mg
      • 10 mg
      Qty:
      - +
      Price: Inquire

      Formula: C183H293N47O59

      Molecular Weight: 4095.66 Da

      Lead Time: Order now, ship in 3 daysWelcome to order from local distributors.

      Add to cart Compare Bulk request Manual

      Product information

      Sequence (One Letter Code) HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
      Sequence (Three Letter Code) His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser-Ser
      Formula C183H293N47O59
      Molecular Weight 4095.66
      Form Lyophilized powder
      Purity > 95%
      Storage Shipped at 4℃. Stored at -20℃ for one year.
      Note For research use only.
      submit review
      • Show all (0)
      • Reviews (0)
      • Q&A (0)
      ... Show All Show Less
      MSDS for ELISA ISO 9001

      Browsing History


        People Also Bought

        Apply for
        *Product Name:
        *Catalog Number:
        *Name:
        *Email:
        *Message:
        *Country:
        How do you know
        Elabscience:

        *Captcha: