Current Position:Home>>Protein Products>>Recombinant Proteins>> Recombinant Human MMP7 protein(N-His)
Cat.No.:PKSH034173
Welcome to order from local distributors.
Add to cart Bulk request
For research use only. Order now, ship in 3 days
Synonyms | MMP-7, MPSL1, PUMP-1 |
Species | Human |
Expression_host | E.coli |
Sequence | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK |
Accession | P09237 |
Mol_Mass | 30.50 kDa |
Tag | N-His |
Bio_Activity | Testing in progress |
Purity | > 98 % as determined by reducing SDS-PAGE. |
Endotoxin level | < 0.1 EU per μg of the protein as determined by the LAL method. |
Storage | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. |
Shipping | This product is provided as lyophilized powder which is shipped with ice packs. |
Formulation | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
Reconstitution | Please refer to the printed manual for detailed information. |